Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
2ZDO Chain:D ((5-109))-FMAEARLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHVRSKNED--ESSPIINNKVITYDIGYSYMK


General information:
TITO was launched using:
RESULT:

Template: 2ZDO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -12066 for 666 contacts (-18.1/contact) +
2D Compatibility (PS) -11293 + (NN) -1765 + (LL) -40
1D Compatibility (HY) -12800 + (ID) 3400
Total energy: -41364.0 ( -62.11 by residue)
QMean score : 0.471

(partial model without unconserved sides chains):
PDB file : Tito_2ZDO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2ZDO-query.scw
PDB file : Tito_Scwrl_2ZDO.pdb: