Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----MYIEI-YTVNGESIRLDDDAKINNISIHELSKADLKNLFNEKCIELTKYDLTYFINTNQVNWFLVSEGIH--------------------------------------------------------------------------------------------------------------------------------
4R29 Chain:A ((21-220))HVVKNIYPEIKHDYFNESPNIYDKKYISGIT--RVAELKQEEFVNEKARRFSYMKTMY--SVCPEAFEPISRNEASTPEGSWLTVISGKRPMGQFSVDSLYNPDLHALCELPDICCKIFPKENNDFLYIVVVYRNDSPLGEQRANRFIELYNIKRDIMQELNYALPELKAVKSEMIIAREMGEIFSYMPGEIDSYMKYINNKL


General information:
TITO was launched using:
RESULT:

Template: 4R29.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 14250 for 270 contacts (52.8/contact) +
2D Compatibility (PS) -6413 + (NN) 3037 + (LL) 584
1D Compatibility (HY) -1600 + (ID) 650
Total energy: 9208.0 ( 34.10 by residue)
QMean score : 0.035

(partial model without unconserved sides chains):
PDB file : Tito_4R29.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4R29-query.scw
PDB file : Tito_Scwrl_4R29.pdb: