Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMVKMIVGLGNPGSKYNDTKHNIGFMAVDRIVKDLDVNFTEDKNFKAEIGSDFINGEKIYFIKPTTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIAHLGTQ-EFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMILNTLDKVDNAVNYYLQTNDFQKTMQKYNGLK
4JC4 Chain:A ((4-193))-VQLIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVADRKYFGLVGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQLGNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AGDWTRAMQKLHSQK


General information:
TITO was launched using:
RESULT:

Template: 4JC4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -114537 for 1617 contacts (-70.8/contact) +
2D Compatibility (PS) -20028 + (NN) -7141 + (LL) 328
1D Compatibility (HY) -10800 + (ID) 3250
Total energy: -155428.0 ( -96.12 by residue)
QMean score : 0.564

(partial model without unconserved sides chains):
PDB file : Tito_4JC4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4JC4-query.scw
PDB file : Tito_Scwrl_4JC4.pdb: