Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEALTFESKYALLYLGGGLLAMIYGLITFFMAFPAFTSRGNVIFTIKTGPSGEIFLRKRSVLFSEVKRLYMGRHQYSLKGIFFEDIIIEKTDGKIVRIPTWNIITNPLFFEAVERYILPHLNEEAQNNWISQFTEVQRKAYLKEFENHPKL 2LV6 Chain:B ((1-26)) ------------------------------------------------------------------------------------------------------------------------------KRRWKKNFIAVSAANRFKKISSSGAL

General information: TITO was launched using: RESULT: Template: 2LV6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 10 -509 -50.90 -19.58 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain B : 0.46 3D Compatibility (PKB) : -50.90 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.632

(partial model without unconserved sides chains): PDB file : Tito_2LV6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LV6-query.scw PDB file : Tito_Scwrl_2LV6.pdb: