Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ME-----VNKESLVADELHRMF--LAGELQITVEED------------------INNISERLRNGDLSLDRLSGEDVFIKETVNEALRRVEQ----- 2E12 Chain:A ((1-93)) MPKYAPHVYTEQAQIATLEHWVKLLDGQERVRIELDDGSMIAGTVAVRPTIQTYRDEQEREGSNGQLRIDHLDAS----QEPQWIWMDRIVAVHPMP

General information: TITO was launched using: RESULT: Template: 2E12.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 140 -8693 -62.09 -137.98 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -62.09 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.336

(partial model without unconserved sides chains): PDB file : Tito_2E12.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2E12-query.scw PDB file : Tito_Scwrl_2E12.pdb: