Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCV----YRWIDDYRHKIERFTDVEEAKKLLGEGWPKQ---------------------- 2KK4 Chain:A ((1-95)) QGHMDLICMYVFKGEESFGESIDVYGDYLIVKVGTEFLAVPKKSIKSVEDGRIVIGEFD--EEEARELGRKWLEEKSKPVTLEELKSYGFGEEGEGS

General information: TITO was launched using: RESULT: Template: 2KK4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 221 9619 43.52 155.14 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 43.52 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.219

(partial model without unconserved sides chains): PDB file : Tito_2KK4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KK4-query.scw PDB file : Tito_Scwrl_2KK4.pdb: