Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---MESKIEILSTINVEHSDDLYKIV----DTLNRTLKRDNL----------------MFGLALDEENKNQAVFTIYRT 2CME Chain:A ((1-78)) VPPALHLVDPQIQLTITADPKVYPIILRLGSNLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK-

General information: TITO was launched using: RESULT: Template: 2CME.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 95 -1873 -19.72 -34.05 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -19.72 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.116

(partial model without unconserved sides chains): PDB file : Tito_2CME.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2CME-query.scw PDB file : Tito_Scwrl_2CME.pdb: