Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------MEKFVEKMLGQALRQYGRNVAIDPLS---PYEKQSLKAALQERRNEEPDEDLHAHIEDIIYD--YVTNQGLFS---------------- 2FOK Chain:A ((287-386)) VPKRVYWEMLATNLTDKEYVRTRRALILEILIKAGSLKIEQIQDNLKKLGFDEVIETIENDIKGLINTGIFIEIKGRFYQLKDHILQFVIPNRLV

General information: TITO was launched using: RESULT: Template: 2FOK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 177 8340 47.12 122.65 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 47.12 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.366

(partial model without unconserved sides chains): PDB file : Tito_2FOK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2FOK-query.scw PDB file : Tito_Scwrl_2FOK.pdb: