Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNEKG--FTLVEM-LIVLFII--SILLLITIPNVTKHNQTIQKKGCEGLQNMVK----------AQMT-AFE---------LDHEGQTPSLADLQSEGYV-----KKDAVCPNGK-RI-IITGGEV------KVEH
4Q6V Chain:A ((77-211))YDWNGAMQPLVSKMLQADGVTAGSVLLVDSVNNRTNGSLN-ANEATETLRNALANNGKFTLVSVQQLSMAKQQLGLSPQDSLGTRSKAIGIARNVGAQYVLYSSASGNVNAPALQMQLMLVQTGEIIWSGKGAVQQ


General information:
TITO was launched using:
RESULT:

Template: 4Q6V.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 298 8572 28.77 88.37
target 2D structure prediction score : 0.46
Monomeric hydrophicity matching model chain A : 0.65

3D Compatibility (PKB) : 28.77
2D Compatibility (Sec. Struct. Predict.) : 0.46
1D Compatibility (Hydrophobicity) : 0.65
QMean score : 0.213

(partial model without unconserved sides chains):
PDB file : Tito_4Q6V.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4Q6V-query.scw
PDB file : Tito_Scwrl_4Q6V.pdb: