Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKRFSTAYLLLGILCSAAVFLIGAPSRALGAEVEHYEPLQVHVQ--------------LEKVYLDGDVSIEHKHEKVFSMDDFWAAYAGWTLVEQK------KGYVLFRK-----QMDDISPLSKVNGYIGVSDNGVISTFHGRPEPASEPIQSFFQIDLERLESHMQKNLL----KGIPFRTKAEFEDVIEHM-------KTYSG------
3C9A Chain:A ((10-217))----DRDVRILYQVGDSEEDLPVCAPNAVCSKIDLYETPWIERQCRCPDGRTCPSSLGVEDGHTIADKTRHYKMCQPVHKLPVCKHFRDYTWTLTTAAELNVTEQIVHCRCPRNSVTYLTKREPIGNDSPGYRYLFACSPLTRLRCQRKQPCKLFTVRKRQEFLDEVNINSLCQCPKGHRCPSHHTQSGVIAGESFLEDNIQTYSGYCMAND


General information:
TITO was launched using:
RESULT:

Template: 3C9A.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 699 4864 6.96 29.30
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain A : 0.60

3D Compatibility (PKB) : 6.96
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 0.60
QMean score : -0.039

(partial model without unconserved sides chains):
PDB file : Tito_3C9A.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3C9A-query.scw
PDB file : Tito_Scwrl_3C9A.pdb: