Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLVNSKEIVMKELLDRYMDQLHMACTCQVCQNDVLALSLNKVSPSYVTDFKKIAYTKAELVDKQKNTAMLVILAESAAVVSESPSDLCQTKQEEAFIN 2E74 Chain:H ((1-29)) ----------------------------------------------------------MEIDVLGWVALLVVFTWSIAMVVWGRNGL-----------

General information: TITO was launched using: RESULT: Template: 2E74.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 10 -1503 -150.25 -51.81 target 2D structure prediction score : 0.10 Monomeric hydrophicity matching model chain H : 0.55 3D Compatibility (PKB) : -150.25 2D Compatibility (Sec. Struct. Predict.) : 0.10 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.203

(partial model without unconserved sides chains): PDB file : Tito_2E74.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2E74-query.scw PDB file : Tito_Scwrl_2E74.pdb: