Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKVAIASDHGGVHIRNEIKELMDELQIEYIDMGCDCGSG-SVDYPDYAFPVAEKVVSGEVDRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREIAKIWLTTEFTG-GRHQTRIGKISDYEEKNL
3K7S Chain:D ((24-169))-RVAIGTDHPAFAIHENLILYVKEAGDEFVPVYCGPKTAESVDYPDFASRVAEMVARKEVEFGVLACGSGIGMSIAANKVPGVRAALCHDHYTAAMSRIHNDANIVCVGERTTGVEVIREIIITFLQTPFSGEERHVRRIEKIRAIE----


General information:
TITO was launched using:
RESULT:

Template: 3K7S.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 792 -46090 -58.19 -320.07
target 2D structure prediction score : 0.61
Monomeric hydrophicity matching model chain D : 0.83

3D Compatibility (PKB) : -58.19
2D Compatibility (Sec. Struct. Predict.) : 0.61
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.424

(partial model without unconserved sides chains):
PDB file : Tito_3K7S.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3K7S-query.scw
PDB file : Tito_Scwrl_3K7S.pdb: