Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNINIVTIGKLKEKYLKQGIEEYTKRLSAYAKIDIIELPDEKAPENLSDQDMKIIKDKEGDRILSKISPDAHVIALAIEGKMKTSEELADTIDKLATYGKSKVTFVIGGSLGLSDTVMK-RADEKLSFSKMTFPH-QLMRLILVEQIYRAFRINRGEPYHK 3IEF Chain:A ((79-153)) ---------------------------------------------------------------------DSPRLLMSPRGRLLNQA-YARSLAR-----SSGVTLVCGRFEGVDERIIEARELEEVSIGDYILSGGETAALVLLDAIVRL-----------

General information: TITO was launched using: RESULT: Template: 3IEF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 259 -20915 -80.75 -286.50 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -80.75 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.362

(partial model without unconserved sides chains): PDB file : Tito_3IEF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IEF-query.scw PDB file : Tito_Scwrl_3IEF.pdb: