Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVSIFYANRLSYSIWNTIPGKYIREELEQNGVTYNELIKYWDITDPSQALPKVNKDNVLLISAKHDQYIDLKDADYLWESWGRPTRYVYNCGHSGIVLCRKKLANDTLSFIREKLV 3OM8 Chain:A ((207-265)) -----------------------------------------------------IERPTLVIAGAYDTVTAASHGELIAASIAGARLVTLPAVHLSNVEFPQAFEGAVLSFLG----

General information: TITO was launched using: RESULT: Template: 3OM8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 200 -21940 -109.70 -371.86 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -109.70 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.358

(partial model without unconserved sides chains): PDB file : Tito_3OM8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3OM8-query.scw PDB file : Tito_Scwrl_3OM8.pdb: