Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNSEHFNLIQRALDATANELKELGTDSSPSVISHAQTDLEKAVEHIYSTDHPFLSSHVINRK 1AS4 Chain:B ((8-15)) ------------------------------------------------RFNRPFLM-------

General information: TITO was launched using: RESULT: Template: 1AS4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1 -265 -265.00 -33.13 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : -265.00 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 1.348

(partial model without unconserved sides chains): PDB file : Tito_1AS4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1AS4-query.scw PDB file : Tito_Scwrl_1AS4.pdb: