Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------MIVKVHICFVVKTASGYCYLNKREAQAAI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4BZW Chain:A ((1-275))MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGN


General information:
TITO was launched using:
RESULT:

Template: 4BZW.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 124 for 108 contacts (1.1/contact) +
2D Compatibility (PS) -3473 + (NN) -1907 + (LL) 0
1D Compatibility (HY) 800 + (ID) 200
Total energy: -4656.0 ( -43.11 by residue)
QMean score : 0.048

(partial model without unconserved sides chains):
PDB file : Tito_4BZW.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4BZW-query.scw
PDB file : Tito_Scwrl_4BZW.pdb: