Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNLLVTGGAGFIGSNFVHHILNKHDDYKVVNLDLLTYAGTMSNLEDIKENPNHVFVEGNICDYDLVKKLVTDHKIDTIVNFAAESHVDRSIINPGIFIETNVQGTLNLLNVAKELNVAKYLQVSTDEVYGSL-----------GETGYFTEETPIAPNSPYSASKASADLLVRSYFETYGLNVNITRCSNNYGPHHFPEKLIPLMITNGLDGENLPIYGDGKNIRDWLHVSDHCAAIDLVIHNGKSGEVYNVGGHNERTNNEIVHIIVDDLNLSKDKIVYVEDRLGHDLRYAIDPKKIETELGWEPKYT-FDTGIKETIEWYVNNEAWWRPLKSRAKLGE
1OC2 Chain:B ((6-333))-NIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVV-GDIADAELVDKLAA--KADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDI-RFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEK-------


General information:
TITO was launched using:
RESULT:

Template: 1OC2.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -141415 for 2811 contacts (-50.3/contact) +
2D Compatibility (PS) -33793 + (NN) -12433 + (LL) 812
1D Compatibility (HY) -24400 + (ID) 7650
Total energy: -218879.0 ( -77.87 by residue)
QMean score : 0.512

(partial model without unconserved sides chains):
PDB file : Tito_1OC2.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1OC2-query.scw
PDB file : Tito_Scwrl_1OC2.pdb: