Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMVKMIVGLGNPGSKYNDTKHNIGFMAVDRIVKDLDVNFTEDKNFKAEIGSDFINGEKIYFIKPTTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIAHLGTQ-EFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMILNTLDKVDNAVNYYLQTNDFQKTMQKYNGLK
4FNO Chain:B ((4-193))-VQLIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVADRKYFGLVGKFSHQGKDVRLLIPTTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQLGNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSIDFALGVLPEML-AGDWTRAMQKLHSQK


General information:
TITO was launched using:
RESULT:

Template: 4FNO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -111725 for 1599 contacts (-69.9/contact) +
2D Compatibility (PS) -19977 + (NN) -6376 + (LL) 328
1D Compatibility (HY) -10800 + (ID) 3250
Total energy: -151800.0 ( -94.93 by residue)
QMean score : 0.574

(partial model without unconserved sides chains):
PDB file : Tito_4FNO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4FNO-query.scw
PDB file : Tito_Scwrl_4FNO.pdb: