Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------MNSKIEEMRITLIETAQKYGMNSKETIQCSQELDILLNTRIKEEMIFGRYLENSRM 2L35 Chain:A ((1-62)) CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQ---

General information: TITO was launched using: RESULT: Template: 2L35.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 69 -5286 -76.60 -99.73 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -76.60 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.357

(partial model without unconserved sides chains): PDB file : Tito_2L35.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L35-query.scw PDB file : Tito_Scwrl_2L35.pdb: