Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MESKIEILSTINVEHSDDLYKIVDTLNRTLKRDNLMFGLALDEENKNQAVFTIYRT 3B1J Chain:C ((4-25)) ----------------------------------EPFFGDYCSENPDAAECLIYDD

General information: TITO was launched using: RESULT: Template: 3B1J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 27 -726 -26.87 -32.98 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain C : 0.60 3D Compatibility (PKB) : -26.87 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.448

(partial model without unconserved sides chains): PDB file : Tito_3B1J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3B1J-query.scw PDB file : Tito_Scwrl_3B1J.pdb: