Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRKEIYLTIQEENNRAAALSSDVISALSSQKK 2BTI Chain:A ((3-60)) MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQP----------------

General information: TITO was launched using: RESULT: Template: 2BTI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 112 -19721 -176.08 -340.01 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.81 3D Compatibility (PKB) : -176.08 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.347

(partial model without unconserved sides chains): PDB file : Tito_2BTI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2BTI-query.scw PDB file : Tito_Scwrl_2BTI.pdb: