Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------MRTFDLTAALGDRANQPEISRLLVAQLMTSNNEDTRKL------RRAQEREQTQELNELAHRLA-----GMASLIHAHA----VERACHQLEIACGESSVRKLADA-----VDDLVTALG----ELQCELHD--WMT-----MTAPQGTAKS-------------
4D10 Chain:H ((14-212))FSFKKLLDQCENQELEAP-GGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPEQQLARLTDYVAFLEN


General information:
TITO was launched using:
RESULT:

Template: 4D10.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -42340 for 739 contacts (-57.3/contact) +
2D Compatibility (PS) -13335 + (NN) -9096 + (LL) 176
1D Compatibility (HY) -5200 + (ID) 1300
Total energy: -71095.0 ( -96.20 by residue)
QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_4D10.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4D10-query.scw
PDB file : Tito_Scwrl_4D10.pdb: