Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------MKRHVIAFGLKIEILKKYKRTLQAH---DDLRQLEPLGFENTQGSVYLKDQ-------------
1WF9 Chain:A ((1-107))GSSGSSGTMLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAFTDMADPNLRISSLNLAHGS-MVYLAYEGERTIRGSGPSSG


General information:
TITO was launched using:
RESULT:

Template: 1WF9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -8814 for 231 contacts (-38.2/contact) +
2D Compatibility (PS) -4781 + (NN) 2163 + (LL) -172
1D Compatibility (HY) -2000 + (ID) 350
Total energy: -13954.0 ( -60.41 by residue)
QMean score : 0.369

(partial model without unconserved sides chains):
PDB file : Tito_1WF9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1WF9-query.scw
PDB file : Tito_Scwrl_1WF9.pdb: