Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTNMSGGRRSMPKRKVKTYQQLIQENKEAIMGNPKLMNVIYDRIDRKHQKNLQEQNNT--------- 1BW5 Chain:A ((1-66)) MKTT--RVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMK

General information: TITO was launched using: RESULT: Template: 1BW5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 104 -5440 -52.30 -95.43 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -52.30 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.446

(partial model without unconserved sides chains): PDB file : Tito_1BW5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BW5-query.scw PDB file : Tito_Scwrl_1BW5.pdb: