Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTNYWIGVVSEQHVLKGAAGGFAQLCHGKKAPLAKMKEGDWLIYYSPRDAYPDGKLLRSFTAIGKVKSGNIYPYQMAPNFIPYRLDIDYYPCHKIGFYDIKSKLEFVQETKHLGFLFRRGHFEISKKDFLTIAQAMGVNISGMAL 4KBM Chain:B ((3-24)) ------------------------------------FKVGDTVVYPH---------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4KBM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1 -774 -774.00 -70.36 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain B : 0.50 3D Compatibility (PKB) : -774.00 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.525

(partial model without unconserved sides chains): PDB file : Tito_4KBM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4KBM-query.scw PDB file : Tito_Scwrl_4KBM.pdb: