Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNIKSDRIMTSDPQKFTVDGVRFFQQYLNKIRPDAMEIDNLIINSDIIKEDLIVHVSKMIDRLALYDLHRKRSIDKHFSAAFTVDINDREEFYSANIADVSIDLNESSGV 3IT9 Chain:B ((235-269)) VLGAKTDRIRFNESEKLLTWGFRFFET-VTPIKPDA---------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3IT9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 23 -918 -39.89 -26.21 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : -39.89 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.386

(partial model without unconserved sides chains): PDB file : Tito_3IT9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IT9-query.scw PDB file : Tito_Scwrl_3IT9.pdb: