Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTCFLVRDLLPLYLEGDCKRETEHVIEEHLKMCSSCRDMYDTMAEPFELESEQAVEEAYLPEEELRFKQRYYGLLIMKAACWFGAAVAMMLIIKLLI 1Q90 Chain:L ((1-32)) ----------------------------------------------------------------MLTITSYVGLLIGALVFTLGIYLGLLKVVKLI-

General information: TITO was launched using: RESULT: Template: 1Q90.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 24 -6196 -258.15 -193.61 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain L : 0.60 3D Compatibility (PKB) : -258.15 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.275

(partial model without unconserved sides chains): PDB file : Tito_1Q90.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Q90-query.scw PDB file : Tito_Scwrl_1Q90.pdb: