Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-ASCN--AGQLAACAPAITAGAT-PSASCCSNLKAQQGCFCQFVKNPT------------YGRY--INSPNARKVVASCGVSVP-------RC----
1FK5 Chain:A ((1-93))AISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNA----ARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN


General information:
TITO was launched using:
RESULT:

Template: 1FK5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -23674 for 360 contacts (-65.8/contact) +
2D Compatibility (PS) -6175 + (NN) 997 + (LL) 440
1D Compatibility (HY) -3200 + (ID) 1000
Total energy: -32612.0 ( -90.59 by residue)
QMean score : 0.482

(partial model without unconserved sides chains):
PDB file : Tito_1FK5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1FK5-query.scw
PDB file : Tito_Scwrl_1FK5.pdb: