Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------QQCSAAQLAACAPAIISGSPP-----TASCCSNLRAQEPCFCQYARNPAYS-----SYINSPNARRTLTSCGIAVPSC------------------------------------------------------
1KNG Chain:A ((50-193))RPAPQTALPPLEGLQADNVQVPGLDPAAFKG-KVSLVNVWASWCVPCHDEAPLLTELGKDKRFQLVGINYKDAADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGPITPDNLRSVLLPQMEKAL


General information:
TITO was launched using:
RESULT:

Template: 1KNG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -21184 for 357 contacts (-59.3/contact) +
2D Compatibility (PS) -6785 + (NN) 2517 + (LL) -28
1D Compatibility (HY) -3200 + (ID) 750
Total energy: -29430.0 ( -82.44 by residue)
QMean score : 0.301

(partial model without unconserved sides chains):
PDB file : Tito_1KNG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1KNG-query.scw
PDB file : Tito_Scwrl_1KNG.pdb: