Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------ATCNPVGLSPCAGAMSGSGPP-----SKLCCSKLREQKPCLCGYYRDPNLR-----QYVDSPNAKKVATACDVHVTC-------------------------------------------------------
1KNG Chain:A ((50-193))RPAPQTALPPLEGLQADNVQVPGLDPAAFKG-KVSLVNVWASWCVPCHDEAPLLTELGKDKRFQLVGINYKDAADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGPITPDNLRSVLLPQMEKAL


General information:
TITO was launched using:
RESULT:

Template: 1KNG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -17904 for 341 contacts (-52.5/contact) +
2D Compatibility (PS) -6694 + (NN) 1970 + (LL) -172
1D Compatibility (HY) -1600 + (ID) 400
Total energy: -24800.0 ( -72.73 by residue)
QMean score : 0.394

(partial model without unconserved sides chains):
PDB file : Tito_1KNG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1KNG-query.scw
PDB file : Tito_Scwrl_1KNG.pdb: