Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLFTIEERMEMIRQVTAHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK
4NAH Chain:B ((1-160))MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK


General information:
TITO was launched using:
RESULT:

Template: 4NAH.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -96648 for 1213 contacts (-79.7/contact) +
2D Compatibility (PS) -17315 + (NN) -8364 + (LL) 0
1D Compatibility (HY) -19600 + (ID) 4800
Total energy: -146727.0 ( -120.96 by residue)
QMean score : 0.530

(partial model without unconserved sides chains):
PDB file : Tito_4NAH.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4NAH-query.scw
PDB file : Tito_Scwrl_4NAH.pdb: