Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------MIQGFYKDQKLHLLED-PM-----QQYTVM-KVEENAVCVYRWIDDYRHKIERFTDV-EEAKKLLGEGWPKQ------------------------------------------------------------------------------------------
4PW1 Chain:A ((16-252))NLLYLNSGEELNLYPWNLYTGQEQELFEEEIVSFAANSVRILGGGSWTDEELYPLIKFRYSGQDLRFLKDMALTEKDGRRYLVNMALDPNGLCYFSYVNQDEREATA--DEMDQALGKLQEDWEKFLSDPLPKTDNAFYMFFMRCQMLSDQMRKEQYSDYIGDNLYTIWELVLKSEFTSLSYDNHIYAMYSNDGGTSMVLIYSPIEERFVGFSLKY


General information:
TITO was launched using:
RESULT:

Template: 4PW1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 105 11322 107.82 182.60
target 2D structure prediction score : 0.40
Monomeric hydrophicity matching model chain A : 0.54

3D Compatibility (PKB) : 107.82
2D Compatibility (Sec. Struct. Predict.) : 0.40
1D Compatibility (Hydrophobicity) : 0.54
QMean score : 0.232

(partial model without unconserved sides chains):
PDB file : Tito_4PW1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4PW1-query.scw
PDB file : Tito_Scwrl_4PW1.pdb: