Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYCPQCGHQ-TDG---GNFCEKCGSPLPGQSGHQHAAQTGAAAKQAAKQFGSFVLSVLKRPYQECKATGGEQLISAIITMVLFSLLTPLMFYILFSDGPGSVSFTAIFLEPTIYFILFLFGLHACIFFALKIAGNQVSFKDSFSRFGAFLIPFTAILILALFFFLLHTDICFTILAVGLIGAFFAIPPAMLSSYQHSYKGKVDFIYSTIVIYLIICVTFQLIIEHYVKEIFRYMLF 1TWF Chain:L ((30-60)) -ICAECSSKLSLSRTDAVRCKDCGHRILLKAR------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1TWF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 65 -1502 -23.10 -55.61 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain L : 0.40 3D Compatibility (PKB) : -23.10 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.40 QMean score : 0.846

(partial model without unconserved sides chains): PDB file : Tito_1TWF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TWF-query.scw PDB file : Tito_Scwrl_1TWF.pdb: