Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIALLGGAVAIDGDSLLPVFVIIGGAVIYFLVVIGIIIWNVIQGIKVLRAA 1UCR Chain:A ((1-74)) MEEAKQKVVDFLNSKSGSKSKFY--FNDFTDLFPDMKQREVKKILTALVN------------------------------DEVLEYWSS--GSTTMYGLKGAGKQAAA

General information: TITO was launched using: RESULT: Template: 1UCR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 243 -52474 -215.94 -709.10 target 2D structure prediction score : 0.47 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : -215.94 2D Compatibility (Sec. Struct. Predict.) : 0.47 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.371

(partial model without unconserved sides chains): PDB file : Tito_1UCR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UCR-query.scw PDB file : Tito_Scwrl_1UCR.pdb: