Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
1FX7 Chain:C ((1-230))MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGV----------LVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV


General information:
TITO was launched using:
RESULT:

Template: 1FX7.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -101059 for 1759 contacts (-57.5/contact) +
2D Compatibility (PS) -24457 + (NN) -15084 + (LL) -464
1D Compatibility (HY) -30000 + (ID) 10950
Total energy: -182014.0 ( -103.48 by residue)
QMean score : 0.869

(partial model without unconserved sides chains):
PDB file : Tito_1FX7.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1FX7-query.scw
PDB file : Tito_Scwrl_1FX7.pdb: