Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSGKASIKDLAVGKGKDLRWGKGLNAVGVFTDLEIGRQREMSAKSCSTPLYIRRSIQFKS 4BEM Chain:J ((115-154)) MASGIAMIAGIGPGTGQGYAAGKGAEAVGIRPEMKSAILRVM-------------------

General information: TITO was launched using: RESULT: Template: 4BEM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain J - contact count / total energy / energy per contact / energy per residue : 33 4456 135.03 111.40 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain J : 0.67 3D Compatibility (PKB) : 135.03 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.67 QMean score : -0.014

(partial model without unconserved sides chains): PDB file : Tito_4BEM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BEM-query.scw PDB file : Tito_Scwrl_4BEM.pdb: