Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEIAFLNSLVVTSPGFYKAEKITLDEVKQWLKHYDGRYKSFIGHKSTAQFLQKLLGIRIEQNRKTFRHMKYQKAICFSLYERYPENVLLTQRDLE----KARYQFYLLTRLD 2J85 Chain:A ((38-113)) ------------------------------LRLEDGTLINAIGHDSTINLVNTLCGTQLQKNRVEVKMNEGDEALIIMISQRLEEGKVLSDKEIKDMYRQGKISFY------

General information: TITO was launched using: RESULT: Template: 2J85.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 182 -24854 -136.56 -345.19 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -136.56 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.413

(partial model without unconserved sides chains): PDB file : Tito_2J85.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2J85-query.scw PDB file : Tito_Scwrl_2J85.pdb: