Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYLGIVSTACAFLLWNHGLQLLNASSGGLFFFFQPLVGTLLGWILLGEQIGGTFWIGSFLILSGVLLVIKEKEKEVKS 4E6K Chain:G ((1-57)) MYVCLCQG-----VTDNQIRDAIYEGCCSYREVREATG-------VGTQCGKC--------ASLAKQVVRETLNDLQ-

General information: TITO was launched using: RESULT: Template: 4E6K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 217 -37883 -174.58 -664.61 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain G : 0.58 3D Compatibility (PKB) : -174.58 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.222

(partial model without unconserved sides chains): PDB file : Tito_4E6K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4E6K-query.scw PDB file : Tito_Scwrl_4E6K.pdb: