Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MERFIKRLSASCESTIHHKVYQIMNEAKTEFEKVLKKLK 1DK0 Chain:A ((127-153)) ----------GHDGVVHQVVYGLMSGDTGALETALNG--

General information: TITO was launched using: RESULT: Template: 1DK0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 42 -1718 -40.89 -63.61 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -40.89 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.226

(partial model without unconserved sides chains): PDB file : Tito_1DK0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DK0-query.scw PDB file : Tito_Scwrl_1DK0.pdb: