Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN 3P03 Chain:A ((149-209)) --------------------------------------VGVAMSTTMFHWTLHPWAI-YAIVGLAIAYSTFRVGRKQ-----

General information: TITO was launched using: RESULT: Template: 3P03.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 29 -3505 -120.84 -92.22 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -120.84 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.58 QMean score : -0.083

(partial model without unconserved sides chains): PDB file : Tito_3P03.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3P03-query.scw PDB file : Tito_Scwrl_3P03.pdb: