Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGGLQTTGYAENASFSQLSACFSSRLVREDLFLMFSAYNQFTLLHSRLTMISYNGDDQ 4LHD Chain:A ((474-520)) --------------WSEVKTSFPADLTRQSLYLQDAVFNQY---HSETELLRY-----

General information: TITO was launched using: RESULT: Template: 4LHD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 19 -1429 -75.18 -39.68 target 2D structure prediction score : 0.03 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -75.18 2D Compatibility (Sec. Struct. Predict.) : 0.03 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.096

(partial model without unconserved sides chains): PDB file : Tito_4LHD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4LHD-query.scw PDB file : Tito_Scwrl_4LHD.pdb: