Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVTGILEIAGALAMTAGIWNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIVSIMIIMGSYT 4C48 Chain:C ((15-38)) -VPVVMAIILGLIYGLGEVFNIFSG-----------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4C48.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 4 -1097 -274.25 -45.71 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain C : 0.44 3D Compatibility (PKB) : -274.25 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.44 QMean score : 0.114

(partial model without unconserved sides chains): PDB file : Tito_4C48.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4C48-query.scw PDB file : Tito_Scwrl_4C48.pdb: