Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKPKKKKFEVTEQQTIDAV---LQQMKEEGYLPVRRMEEPIFMEKKENGSIQIVPCGKKIVFEGKLI 4EUK Chain:B ((110-153)) ------------EQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIP------------

General information: TITO was launched using: RESULT: Template: 4EUK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 14 -451 -32.18 -10.99 target 2D structure prediction score : 0.22 Monomeric hydrophicity matching model chain B : 0.71 3D Compatibility (PKB) : -32.18 2D Compatibility (Sec. Struct. Predict.) : 0.22 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.223

(partial model without unconserved sides chains): PDB file : Tito_4EUK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4EUK-query.scw PDB file : Tito_Scwrl_4EUK.pdb: