Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQYFSPEQQYNAWIVSDLVKQIFHKRAGCSPGIHELAVFAEEHFHIDIDFVFSIIMNIGDIEFALTDEIEKKLSGYLSTLLPYVTADMFETSKANAHAFLSRRHGNAAYHLFVSDDAFMRKQ 3J0E Chain:H ((153-204)) -----------------VVNQI-KTRLGANPVPLQLAIGAEEHFTGVVDLVKMKAINWNDADQGVTFEYE----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3J0E.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 112 -10792 -96.35 -207.53 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain H : 0.61 3D Compatibility (PKB) : -96.35 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.062

(partial model without unconserved sides chains): PDB file : Tito_3J0E.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3J0E-query.scw PDB file : Tito_Scwrl_3J0E.pdb: