Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence METTKLG-NLKLYGAGHAAG--GAYHNVSIKGEGIVGEGLSAVGCRIYGTGLFLG---KAETERLRVLGESECKGDLTAGKINIYGTMKVSGSLQFDRFNLKGQTEIGGNMTGESCDVKGKLSVIGDCETEMFHVTGCVDVSGLLNSGEIKLGLSHDISHVQEIGGTTITVKRRASFFSRKKGKLIADVIEGDRVYLENTEAAVVRGKEVIIGPGCSIGTIEYEYKCECDPHSQIKEKTKL 4E75 Chain:A ((263-330)) --STKIGKNCILAGACGVAGHLSIADNVTLTGMSMVTKNISEAGTYSSGTGLFENNHWKKTIVRLRQLAD---------------------------------------------------------------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4E75.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 173 -28818 -166.58 -464.81 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -166.58 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.134

(partial model without unconserved sides chains): PDB file : Tito_4E75.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4E75-query.scw PDB file : Tito_Scwrl_4E75.pdb: