Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKAVIAKNEEQLKDAFYVREEVFVKEQNVPAEEEIDELENESEHIVVYDGEKPVGAGRWRMKDGYGKLERICVLKSHRSAGVGGIIMKALEKAAADGGASGFILNAQTQAVPFYKKHGYRVLSEKEFLDAGIPHLQMMKD 3FB3 Chain:A ((79-142)) -----------------------------------------------------------------GHIEDVVVDPSYRGAGLGKALIMDLCEISRSKGCYKVILDSSEKSLPFYEKLGFRAHERQMRLD-----------

General information: TITO was launched using: RESULT: Template: 3FB3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 130 -26207 -201.59 -409.48 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -201.59 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.576

(partial model without unconserved sides chains): PDB file : Tito_3FB3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FB3-query.scw PDB file : Tito_Scwrl_3FB3.pdb: