Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGDVNYFLTFGAGFLSFISPCCLPLYPAFLSYITGVSMDDVKTEKLLLQKRSLFHTLCFLLGFSVIFIALGYGTSFIGSLFRDYHDAIRQIGALLIILFGFITLGVFRPEAMMKERRIHFKHKPSGFLGSVLIGMAFAAGWTPCTGPILAAVITLAGTNPGSAVPYMMLYVLGFAVPFLLLSFFITKLKWIRKNQLFIMKAGGVLMIVIGVLLFFNWMSLIIILLSDLFGGFTGF 2Y69 Chain:L ((43-55)) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------LFFGSGFAAPFFI-------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2Y69.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 2 -504 -251.75 -38.73 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain L : 0.37 3D Compatibility (PKB) : -251.75 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.37 QMean score : 0.150

(partial model without unconserved sides chains): PDB file : Tito_2Y69.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Y69-query.scw PDB file : Tito_Scwrl_2Y69.pdb: