Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSFYH-YLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGR 5D0U Chain:A ((546-595)) MKKWCHEHFLSYRHLSSADNVRAQLKKIMETHGIELVSTPFHDKNYYTNI-------------------------

General information: TITO was launched using: RESULT: Template: 5D0U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 49 4736 96.65 96.65 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : 96.65 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.406

(partial model without unconserved sides chains): PDB file : Tito_5D0U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5D0U-query.scw PDB file : Tito_Scwrl_5D0U.pdb: