Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSQSNYRPSVPRWVGDILELDKKRRQNQYRGSLTSGQEKKDWDEWKRRYSRKLKYARLNGWTIEEE 2O5P Chain:A ((314-368)) -------PKGSGWSGSFPLFDSQGNRNDVSRSFNNGAKWSSWEQYTRTVFANLEHNFANGWV----

General information: TITO was launched using: RESULT: Template: 2O5P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 82 14043 171.25 255.32 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : 171.25 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.281

(partial model without unconserved sides chains): PDB file : Tito_2O5P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2O5P-query.scw PDB file : Tito_Scwrl_2O5P.pdb: