Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVMSKQMRFDNSEVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNKMGVHIWDQWKQEDGTIGHAYGFQLGKKNRSLNGEKVDQVDYLLHQLKNNPSSRRHITMLWNPDDLDAMSLTPCVYETQWYVKHGKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEVKDFYNFTIDDFKLINYKHGDKLLFEVAV
1BKP Chain:A ((2-279))-TQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVISKQMRFDNSEVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMGVHIWDQWKQEDGTIGHAYGFQLGKKNRSLNGEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKHGKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEVKDFYDFTIDDFKLINYKHGDKLLFEVAV


General information:
TITO was launched using:
RESULT:

Template: 1BKP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1359 -124603 -91.69 -448.21
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain A : 0.99

3D Compatibility (PKB) : -91.69
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.99
QMean score : 0.692

(partial model without unconserved sides chains):
PDB file : Tito_1BKP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1BKP-query.scw
PDB file : Tito_Scwrl_1BKP.pdb: